Lineage for d1nv9a_ (1nv9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130130Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 protein domains)
  6. 2130131Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 2130135Species Thermotoga maritima [TaxId:2336] [89745] (3 PDB entries)
    Uniprot Q9WYV8
  8. 2130141Domain d1nv9a_: 1nv9 A: [86226]
    complexed with sah

Details for d1nv9a_

PDB Entry: 1nv9 (more details), 2.36 Å

PDB Description: HemK, apo structure
PDB Compounds: (A:) hemK protein

SCOPe Domain Sequences for d1nv9a_:

Sequence, based on SEQRES records: (download)

>d1nv9a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}
kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
milsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqv
eelkkivsdtvflkdsagkyrflllnrrss

Sequence, based on observed residues (ATOM records): (download)

>d1nv9a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}
kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
milsnppyvkssalfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkki
vsdtvflkdsagkyrflllnrrss

SCOPe Domain Coordinates for d1nv9a_:

Click to download the PDB-style file with coordinates for d1nv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nv9a_: