Lineage for d1nv8a_ (1nv8 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318334Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 318335Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) (S)
  5. 318649Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (1 protein)
  6. 318650Protein N5-glutamine methyltransferase, HemK [89744] (1 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 318651Species Thermatoga maritima [89745] (2 PDB entries)
  8. 318652Domain d1nv8a_: 1nv8 A: [86224]

Details for d1nv8a_

PDB Entry: 1nv8 (more details), 2.2 Å

PDB Description: n5-glutamine methyltransferase, hemk

SCOP Domain Sequences for d1nv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermatoga maritima}
rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
emilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedq
veelkkivsdtvflkdsagkyrflllnrrss

SCOP Domain Coordinates for d1nv8a_:

Click to download the PDB-style file with coordinates for d1nv8a_.
(The format of our PDB-style files is described here.)

Timeline for d1nv8a_: