Lineage for d1nusa_ (1nus A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860374Protein Cytosolic NMN/NAMN adenylyltransferase [89613] (1 species)
  7. 2860375Species Human (Homo sapiens), FKSG76 [TaxId:9606] [89614] (6 PDB entries)
  8. 2860384Domain d1nusa_: 1nus A: [86205]
    complexed with apc, nmn, so4

Details for d1nusa_

PDB Entry: 1nus (more details), 2.2 Å

PDB Description: crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with atp analog and nmn
PDB Compounds: (A:) fksg76

SCOPe Domain Sequences for d1nusa_:

Sequence, based on SEQRES records: (download)

>d1nusa_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]}
sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkalfs
tpaavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespil
rmhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglyt

Sequence, based on observed residues (ATOM records): (download)

>d1nusa_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]}
sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllavpelkllcgadvlktf
qtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisa
tyirralgqgqsvkylipdavityikdhglyt

SCOPe Domain Coordinates for d1nusa_:

Click to download the PDB-style file with coordinates for d1nusa_.
(The format of our PDB-style files is described here.)

Timeline for d1nusa_: