Lineage for d1nurb_ (1nur B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105663Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2105664Protein Cytosolic NMN/NAMN adenylyltransferase [89613] (1 species)
  7. 2105665Species Human (Homo sapiens), FKSG76 [TaxId:9606] [89614] (6 PDB entries)
  8. 2105675Domain d1nurb_: 1nur B: [86204]
    complexed with so4

Details for d1nurb_

PDB Entry: 1nur (more details), 2.15 Å

PDB Description: crystal structure of human cytosolic nmn/namn adenylyltransferase
PDB Compounds: (B:) fksg76

SCOPe Domain Sequences for d1nurb_:

Sequence, based on SEQRES records: (download)

>d1nurb_ c.26.1.3 (B:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]}
ripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaashh
rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkalfst
paavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilr
mhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglyt

Sequence, based on observed residues (ATOM records): (download)

>d1nurb_ c.26.1.3 (B:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]}
ripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaashh
rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrvpelkllcgadvlktfq
tpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisat
yirralgqgqsvkylipdavityikdhglyt

SCOPe Domain Coordinates for d1nurb_:

Click to download the PDB-style file with coordinates for d1nurb_.
(The format of our PDB-style files is described here.)

Timeline for d1nurb_: