![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
![]() | Protein Cytosolic NMN/NAMN adenylyltransferase [89613] (1 species) |
![]() | Species Human (Homo sapiens), FKSG76 [TaxId:9606] [89614] (6 PDB entries) |
![]() | Domain d1nupb_: 1nup B: [86200] complexed with nmn, so4 |
PDB Entry: 1nup (more details), 1.9 Å
SCOPe Domain Sequences for d1nupb_:
Sequence, based on SEQRES records: (download)
>d1nupb_ c.26.1.3 (B:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkalfs tpaavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespil rmhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglyt
>d1nupb_ c.26.1.3 (B:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrvpelkllcgadvlktf qtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisa tyirralgqgqsvkylipdavityikdhglyt
Timeline for d1nupb_: