Lineage for d1nuoa_ (1nuo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009325Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 2009326Species Human (Homo sapiens) [TaxId:9606] [48531] (16 PDB entries)
    Uniprot P10828 202-460
  8. 2009343Domain d1nuoa_: 1nuo A: [86198]
    complexed with 4hy; mutant

Details for d1nuoa_

PDB Entry: 1nuo (more details), 3.1 Å

PDB Description: Two RTH Mutants with Impaired Hormone Binding
PDB Compounds: (A:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d1nuoa_:

Sequence, based on SEQRES records: (download)

>d1nuoa_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
meelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpddigqapivnape
ggkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslhaavr
ydpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllms
sdrpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrfl
hmkvecptelfpplflevfe

Sequence, based on observed residues (ATOM records): (download)

>d1nuoa_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
meelqksighkpeptdeeweliktvteahvatnagshwkqkrkflpddigqdleafshft
kiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslhaavrydpesetltlnge
mavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacverie
kyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpp
lflevfe

SCOPe Domain Coordinates for d1nuoa_:

Click to download the PDB-style file with coordinates for d1nuoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nuoa_: