Lineage for d1nugb4 (1nug B:141-459)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324261Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 324262Superfamily d.3.1: Cysteine proteinases [54001] (9 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 324460Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 324461Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 324477Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (5 PDB entries)
  8. 324483Domain d1nugb4: 1nug B:141-459 [86193]
    Other proteins in same PDB: d1nuga1, d1nuga2, d1nuga3, d1nugb1, d1nugb2, d1nugb3
    complexed with ca, cl, mg; mutant

Details for d1nugb4

PDB Entry: 1nug (more details), 2.4 Å

PDB Description: Role of Calcium Ions in the Activation and Activity of the Transglutaminase 3 Enzyme (2 calciums, 1 Mg, inactive form)

SCOP Domain Sequences for d1nugb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nugb4 d.3.1.4 (B:141-459) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgkl

SCOP Domain Coordinates for d1nugb4:

Click to download the PDB-style file with coordinates for d1nugb4.
(The format of our PDB-style files is described here.)

Timeline for d1nugb4: