SCOP 1.65: Domain d1nufa1: 1nuf A:1-140

Lineage for d1nufa1 (1nuf A:1-140)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (5 PDB entries)

8. Domain d1nufa1: 1nuf A:1-140 [86182]
   Other proteins in same PDB: d1nufa2, d1nufa3, d1nufa4
   complexed with br, ca, cl; mutant

Details for d1nufa1

PDB Entry: 1nuf, 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme

SCOP Domain Sequences for d1nufa1:

Sequence; same for both SEQRES and ATOM records:

>d1nufa1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

Timeline for d1nufa1:

• d1nufa1 is new in SCOP 1.65
  
• d1nufa1 appears in SCOP 1.67
  
• d1nufa1 appears in the current release, SCOPe 2.08