Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (5 PDB entries) |
Domain d1nudb3: 1nud B:594-692 [86180] Other proteins in same PDB: d1nuda1, d1nuda4, d1nudb1, d1nudb4 complexed with br, ca, cl |
PDB Entry: 1nud (more details), 2.7 Å
SCOPe Domain Sequences for d1nudb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nudb3 b.1.5.1 (B:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae
Timeline for d1nudb3:
View in 3D Domains from other chains: (mouse over for more information) d1nuda1, d1nuda2, d1nuda3, d1nuda4 |