Lineage for d1nudb3 (1nud B:594-692)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768856Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 1768857Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 1768858Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 1768892Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (5 PDB entries)
  8. 1768910Domain d1nudb3: 1nud B:594-692 [86180]
    Other proteins in same PDB: d1nuda1, d1nuda4, d1nudb1, d1nudb4
    complexed with br, ca, cl

Details for d1nudb3

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)
PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1nudb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nudb3 b.1.5.1 (B:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae

SCOPe Domain Coordinates for d1nudb3:

Click to download the PDB-style file with coordinates for d1nudb3.
(The format of our PDB-style files is described here.)

Timeline for d1nudb3: