Lineage for d1nudb1 (1nud B:1-140)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362437Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2362438Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2362458Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)
  8. 2362475Domain d1nudb1: 1nud B:1-140 [86178]
    Other proteins in same PDB: d1nuda2, d1nuda3, d1nuda4, d1nudb2, d1nudb3, d1nudb4
    complexed with br, ca, cl

Details for d1nudb1

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: Role of Calcium Ions in the Activation and Activity of the Transglutaminase 3 Enzyme (3 calciums, active form)
PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1nudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nudb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1nudb1:

Click to download the PDB-style file with coordinates for d1nudb1.
(The format of our PDB-style files is described here.)

Timeline for d1nudb1: