SCOP 1.65: Domain d1ntva_: 1ntv A:

Lineage for d1ntva_ (1ntv A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (6 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (5 proteins)

6. Protein Disabled homolog 1 (Dab1) [89357] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89358] (2 PDB entries)

8. Domain d1ntva_: 1ntv A: [86168]
   complexed with apoer2 peptide
   complexed with po4

Details for d1ntva_

PDB Entry: 1ntv, 1.5 Å

PDB Description: crystal structure of the disabled-1 (dab1) ptb domain-apoer2 peptide complex

SCOP Domain Sequences for d1ntva_:

Sequence; same for both SEQRES and ATOM records:

>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus)}
gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
taqaaepvildlrdlfqliyelkqreelekka

Timeline for d1ntva_:

• d1ntva_ is new in SCOP 1.65
  
• d1ntva_ appears in SCOP 1.67
  
• d1ntva_ appears in the current release, SCOPe 2.08