Lineage for d1ntgd_ (1ntg D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463674Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 463675Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species)
    EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity
  7. 463676Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry)
  8. 463680Domain d1ntgd_: 1ntg D: [86167]

Details for d1ntgd_

PDB Entry: 1ntg (more details), 2.21 Å

PDB Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase

SCOP Domain Sequences for d1ntgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntgd_ b.40.4.4 (D:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens)}
peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle

SCOP Domain Coordinates for d1ntgd_:

Click to download the PDB-style file with coordinates for d1ntgd_.
(The format of our PDB-style files is described here.)

Timeline for d1ntgd_: