SCOP 1.73: Domain d1ntgc_: 1ntg C:

Lineage for d1ntgc_ (1ntg C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.4: Myf domain [50277] (6 proteins)

6. Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species)
   EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity

7. Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry)

8. Domain d1ntgc_: 1ntg C: [86166]

Details for d1ntgc_

PDB Entry: 1ntg, 2.21 Å

PDB Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase

PDB Compounds: (C:) Tyrosyl-tRNA synthetase

SCOP Domain Sequences for d1ntgc_:

Sequence; same for both SEQRES and ATOM records:

>d1ntgc_ b.40.4.4 (C:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]}
peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle

Timeline for d1ntgc_:

• d1ntgc_ first appeared in SCOP 1.65
  
• d1ntgc_ appears in SCOP 1.71
  
• d1ntgc_ appears in SCOP 1.75
  
• d1ntgc_ appears in the current release, SCOPe 2.08, called d1ntgc1