Lineage for d1ntga1 (1ntg A:2-170)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059726Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2059727Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species)
    EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity
  7. 2059728Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry)
  8. 2059729Domain d1ntga1: 1ntg A:2-170 [86164]
    Other proteins in same PDB: d1ntga2, d1ntgb2, d1ntgc2, d1ntgd2

Details for d1ntga1

PDB Entry: 1ntg (more details), 2.21 Å

PDB Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1ntga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntga1 b.40.4.4 (A:2-170) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]}
peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnis

SCOPe Domain Coordinates for d1ntga1:

Click to download the PDB-style file with coordinates for d1ntga1.
(The format of our PDB-style files is described here.)

Timeline for d1ntga1: