Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.4: Myf domain [50277] (7 proteins) |
Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species) EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity |
Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry) |
Domain d1ntga1: 1ntg A:2-170 [86164] Other proteins in same PDB: d1ntga2, d1ntgb2, d1ntgc2, d1ntgd2 |
PDB Entry: 1ntg (more details), 2.21 Å
SCOPe Domain Sequences for d1ntga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntga1 b.40.4.4 (A:2-170) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]} peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnis
Timeline for d1ntga1: