SCOPe 2.05: Domain d1ntga_: 1ntg A:

Lineage for d1ntga_ (1ntg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species)
   EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity

7. Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry)

8. Domain d1ntga_: 1ntg A: [86164]

Details for d1ntga_

PDB Entry: 1ntg, 2.21 Å

PDB Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1ntga_:

Sequence; same for both SEQRES and ATOM records:

>d1ntga_ b.40.4.4 (A:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]}
peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle

Timeline for d1ntga_:

• d1ntga_ first appeared in SCOP 1.65
  
• d1ntga_ appears in SCOPe 2.04
  
• d1ntga_ is called d1ntga1 in SCOPe 2.06
  
• d1ntga_ appears in the current release, SCOPe 2.08, called d1ntga1