SCOPe 2.02: Domain d1ntea_: 1nte A:

Lineage for d1ntea_ (1nte A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1ntea_: 1nte A: [86163]
   second PDZ domain
   complexed with o

Details for d1ntea_

PDB Entry: 1nte, 1.24 Å

PDB Description: crystal structure analysis of the second pdz domain of syntenin

PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1ntea_:

Sequence; same for both SEQRES and ATOM records:

>d1ntea_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitimpaf

Timeline for d1ntea_:

• d1ntea_ first appeared in SCOP 1.65
  
• d1ntea_ appears in SCOPe 2.01
  
• d1ntea_ appears in SCOPe 2.03
  
• d1ntea_ appears in the current release, SCOPe 2.08, called d1ntea1