SCOPe 2.08: Domain d1ntea1: 1nte A:197-273

Lineage for d1ntea1 (1nte A:197-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1ntea1: 1nte A:197-273 [86163]
   Other proteins in same PDB: d1ntea2
   second PDZ domain
   complexed with o

Details for d1ntea1

PDB Entry: 1nte, 1.24 Å

PDB Description: crystal structure analysis of the second pdz domain of syntenin

PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1ntea1:

Sequence; same for both SEQRES and ATOM records:

>d1ntea1 b.36.1.1 (A:197-273) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitimpaf

Timeline for d1ntea1:

• d1ntea1 first appeared in SCOP 1.65, called d1ntea_
  
• d1ntea1 appears in SCOPe 2.07