Lineage for d1nt9i_ (1nt9 I:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270442Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2270443Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2270444Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2270445Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2270446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2270528Domain d1nt9i_: 1nt9 I: [86159]
    protein/DNA complex; protein/RNA complex

Details for d1nt9i_

PDB Entry: 1nt9 (more details), 4.2 Å

PDB Description: Complete 12-subunit RNA polymerase II
PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOPe Domain Sequences for d1nt9i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nt9i_ i.8.1.1 (I:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvqd
igsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq

SCOPe Domain Coordinates for d1nt9i_:

Click to download the PDB-style file with coordinates for d1nt9i_.
(The format of our PDB-style files is described here.)

Timeline for d1nt9i_: