SCOPe 2.06: Domain d1nt9f_: 1nt9 F:

Lineage for d1nt9f_ (1nt9 F:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1nt9f_: 1nt9 F: [86156]
   protein/DNA complex; protein/RNA complex

Details for d1nt9f_

PDB Entry: 1nt9, 4.2 Å

PDB Description: Complete 12-subunit RNA polymerase II

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1nt9f_:

Sequence; same for both SEQRES and ATOM records:

>d1nt9f_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d1nt9f_:

• d1nt9f_ first appeared in SCOP 1.65
  
• d1nt9f_ appears in SCOPe 2.05
  
• d1nt9f_ appears in SCOPe 2.07
  
• d1nt9f_ appears in the current release, SCOPe 2.08