Lineage for d1nt9a_ (1nt9 A:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2595068Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2595069Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2595070Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2595071Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2595072Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2595142Domain d1nt9a_: 1nt9 A: [86151]
    protein/DNA complex; protein/RNA complex

Details for d1nt9a_

PDB Entry: 1nt9 (more details), 4.2 Å

PDB Description: Complete 12-subunit RNA polymerase II
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1nt9a_:

Sequence, based on SEQRES records: (download)

>d1nt9a_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmideeslvky

Sequence, based on observed residues (ATOM records): (download)

>d1nt9a_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswkl
rvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpseddltfklad
ilkanisletlehngaphhaieeaesllqfhvatymdndiagqsirarlkgkegrirgnl
mgkrvdfsartvisgdpnleldqvgvpksiaktltypevvtpynidrltqlvrngpnehp
gakyvirdsgdridlryskragdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrv
kvipystfrlnlsvtspynadfdgdemnlhvpqseetraelsqlcavplqivspqsnkpc
mgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsv
aipngihlqrfdegttllspkdngmliidgqiifgvvekktvgssngglihvvtrekgpq
vcaklfgniqkvvnfwllhngfstgigdtiadgptmreitetiaeakkkvldvtkeaqan
lltakhgmtlresfednvvrflneardkagrlaevnlkdlnnvkqmvmagskgsfiniaq
msacvgqqsvegkriafgfvdrtlphfskddyspeskgfvensylrgltpqefffhamgg
reglidtavktaetgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmdaahiek
qsldtiggsdaafekryrvdllntdhtldpsllesgseilgdlklqvlldeeykqlvkdr
kflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvl
rgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhp
gemvgvlaaqsigepatqmtlkkvtsgvprlkeilnvaknmktpsltvylepghaadqeq
aklirsaiehttlksvtiaseiyydpdprstvipedeeiiqlhfslqqspwllrleldra
amndkdltmgqvgerikqtfkndlfviwsedndekliircrvvaeedhmlkkientmlen
itlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidptriytn
sfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggltsvtrhgfn
rsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafdvmideesl
vky

SCOPe Domain Coordinates for d1nt9a_:

Click to download the PDB-style file with coordinates for d1nt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nt9a_: