Lineage for d1nt2b_ (1nt2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014351Fold a.183: Nop domain [89123] (1 superfamily)
    multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain
  4. 2014352Superfamily a.183.1: Nop domain [89124] (2 families) (S)
  5. 2014353Family a.183.1.1: Nop domain [89125] (2 protein domains)
    putative snoRNA binding domain
  6. 2014354Protein Nop5p [89126] (1 species)
    also contains an N-terminal, fibrillarin-binding alpha+beta subdomain
  7. 2014355Species Archaeoglobus fulgidus [TaxId:2234] [89127] (1 PDB entry)
    AF2088
  8. 2014356Domain d1nt2b_: 1nt2 B: [86150]
    Other proteins in same PDB: d1nt2a_
    structural genomics; complex with fibrillarin (AF20087)
    protein/RNA complex; complexed with sam

Details for d1nt2b_

PDB Entry: 1nt2 (more details), 2.9 Å

PDB Description: crystal structure of fibrillarin/nop5p complex
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1nt2b_:

Sequence, based on SEQRES records: (download)

>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeoglobus fulgidus [TaxId: 2234]}
lrynlwfgvydgkeiklsenfeesflkaenpsplpfnvsevgakalgkdyyrilrktala
vsekmvekelrredryvvalvkaleeidesinmlneklediravkeseitekfekkirel
relrrdvereieevmekiapnmtelvgakvaaklleragsmerlvrlpaskiqvigaeks
lykafarmkkgkkakipkhgiiflhpfirtlpkakrgkmarflaaklaiaakidyfrgei
deslyesirrryeelr

Sequence, based on observed residues (ATOM records): (download)

>d1nt2b_ a.183.1.1 (B:) Nop5p {Archaeoglobus fulgidus [TaxId: 2234]}
lrynlwfgvydgkeiklsenfeesflkaenpsplpfnvsevgakalgkdyyrilrktala
vsekmvekelrredryvvalvkaleeidesinmlneklediravkeseitekfekkirel
relrrdvereieevmekiapnmtelvgakvaaklleragsmerlvrlpaskiqvigaehg
iiflhpfirtlpkakrgkmarflaaklaiaakidyfrgeideslyesirrryeelr

SCOPe Domain Coordinates for d1nt2b_:

Click to download the PDB-style file with coordinates for d1nt2b_.
(The format of our PDB-style files is described here.)

Timeline for d1nt2b_: