Lineage for d1nt0g3 (1nt0 G:120-164)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342241Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (1 species)
    EGF-like domain separates two CUB domains
  7. 342242Species Rat (Rattus norvegicus) [TaxId:10116] [90142] (1 PDB entry)
  8. 342244Domain d1nt0g3: 1nt0 G:120-164 [86148]
    Other proteins in same PDB: d1nt0a1, d1nt0a2, d1nt0g1, d1nt0g2
    complexed with ahb, ca, edo, nag

Details for d1nt0g3

PDB Entry: 1nt0 (more details), 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2

SCOP Domain Sequences for d1nt0g3:

Sequence, based on SEQRES records: (download)

>d1nt0g3 g.3.11.1 (G:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
vdecrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsal

Sequence, based on observed residues (ATOM records): (download)

>d1nt0g3 g.3.11.1 (G:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
vdecrpcdhychnylggyycscrvgyilhqnkhtcsal

SCOP Domain Coordinates for d1nt0g3:

Click to download the PDB-style file with coordinates for d1nt0g3.
(The format of our PDB-style files is described here.)

Timeline for d1nt0g3: