Lineage for d1nt0g1 (1nt0 G:5-119)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370923Fold b.23: CUB-like [49853] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 370924Superfamily b.23.1: Spermadhesin, CUB domain [49854] (1 family) (S)
  5. 370925Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)
  6. 370939Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (1 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 370940Species Rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry)
  8. 370943Domain d1nt0g1: 1nt0 G:5-119 [86146]
    Other proteins in same PDB: d1nt0a3, d1nt0g3

Details for d1nt0g1

PDB Entry: 1nt0 (more details), 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2

SCOP Domain Sequences for d1nt0g1:

Sequence, based on SEQRES records: (download)

>d1nt0g1 b.23.1.1 (G:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
kvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

Sequence, based on observed residues (ATOM records): (download)

>d1nt0g1 b.23.1.1 (G:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaed

SCOP Domain Coordinates for d1nt0g1:

Click to download the PDB-style file with coordinates for d1nt0g1.
(The format of our PDB-style files is described here.)

Timeline for d1nt0g1: