Lineage for d1nslb_ (1nsl B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333011Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 333012Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families) (S)
  5. 333013Family d.108.1.1: N-acetyl transferase, NAT [55730] (14 proteins)
  6. 333089Protein Probable acetyltransferase YdaF [90015] (1 species)
  7. 333090Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)
  8. 333092Domain d1nslb_: 1nsl B: [86138]

Details for d1nslb_

PDB Entry: 1nsl (more details), 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase

SCOP Domain Sequences for d1nslb_:

Sequence, based on SEQRES records: (download)

>d1nslb_ d.108.1.1 (B:) Probable acetyltransferase YdaF {Bacillus subtilis}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records): (download)

>d1nslb_ d.108.1.1 (B:) Probable acetyltransferase YdaF {Bacillus subtilis}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffssadtyretiipdwrrqya
dlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafe
elelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

SCOP Domain Coordinates for d1nslb_:

Click to download the PDB-style file with coordinates for d1nslb_.
(The format of our PDB-style files is described here.)

Timeline for d1nslb_: