SCOP 1.73: Domain d1nshb_: 1nsh B:

Lineage for d1nshb_ (1nsh B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Rabbit (Oryctolagus cuniculus), calgizzarin s100a11 [TaxId:9986] [89047] (1 PDB entry)

8. Domain d1nshb_: 1nsh B: [86136]

Details for d1nshb_

PDB Entry: 1nsh

PDB Description: solution structure of rabbit apo-s100a11 (19 models)

PDB Compounds: (B:) Calgizzarin

SCOP Domain Sequences for d1nshb_:

Sequence; same for both SEQRES and ATOM records:

>d1nshb_ a.39.1.2 (B:) Calcyclin (S100) {Rabbit (Oryctolagus cuniculus), calgizzarin s100a11 [TaxId: 9986]}
srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
kkldlnsdgqldfqeflnligglavachesfvkaappqkrf

Timeline for d1nshb_:

• d1nshb_ first appeared in SCOP 1.65
  
• d1nshb_ appears in SCOP 1.71
  
• d1nshb_ appears in SCOP 1.75
  
• d1nshb_ appears in the current release, SCOPe 2.08