Lineage for d1nsha_ (1nsh A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355207Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 355208Protein Calcyclin (S100) [47479] (16 species)
  7. 355291Species Rabbit (Oryctolagus cuniculus), calgizzarin s100a11 [TaxId:9986] [89047] (1 PDB entry)
  8. 355292Domain d1nsha_: 1nsh A: [86135]

Details for d1nsha_

PDB Entry: 1nsh (more details)

PDB Description: solution structure of rabbit apo-s100a11 (19 models)

SCOP Domain Sequences for d1nsha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsha_ a.39.1.2 (A:) Calcyclin (S100) {Rabbit (Oryctolagus cuniculus), calgizzarin s100a11}
srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
kkldlnsdgqldfqeflnligglavachesfvkaappqkrf

SCOP Domain Coordinates for d1nsha_:

Click to download the PDB-style file with coordinates for d1nsha_.
(The format of our PDB-style files is described here.)

Timeline for d1nsha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nshb_