Lineage for d1nrzd_ (1nrz D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 314729Fold c.38: PTS IIb component [52727] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156
  4. 314730Superfamily c.38.1: PTS IIb component [52728] (1 family) (S)
  5. 314731Family c.38.1.1: PTS IIb component [52729] (2 proteins)
  6. 314735Protein Sorbose permease subunit IIb , EIIb-sor [89690] (1 species)
  7. 314736Species Klebsiella pneumoniae [TaxId:573] [89691] (1 PDB entry)
  8. 314740Domain d1nrzd_: 1nrz D: [86134]
    complexed with so4

Details for d1nrzd_

PDB Entry: 1nrz (more details), 1.75 Å

PDB Description: Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution

SCOP Domain Sequences for d1nrzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrzd_ c.38.1.1 (D:) Sorbose permease subunit IIb , EIIb-sor {Klebsiella pneumoniae}
mqitlariddrlihgqvttvwskvanaqriiicnddvfndevrrtllrqaappgmkvnvv
slekavavyhnpqyqdetvfylftnphdvltmvrqgvqiatlniggmawrpgkkqltkav
sldpqdiqafreldklgvkldlrvvasdpsvnildkinetafc

SCOP Domain Coordinates for d1nrzd_:

Click to download the PDB-style file with coordinates for d1nrzd_.
(The format of our PDB-style files is described here.)

Timeline for d1nrzd_: