SCOP 1.65: Domain d1nrza_: 1nrz A:

Lineage for d1nrza_ (1nrz A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (1 family)

5. Family c.38.1.1: PTS IIb component [52729] (2 proteins)

6. Protein Sorbose permease subunit IIb , EIIb-sor [89690] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [89691] (1 PDB entry)

8. Domain d1nrza_: 1nrz A: [86131]

Details for d1nrza_

PDB Entry: 1nrz, 1.75 Å

PDB Description: Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution

SCOP Domain Sequences for d1nrza_:

Sequence; same for both SEQRES and ATOM records:

>d1nrza_ c.38.1.1 (A:) Sorbose permease subunit IIb , EIIb-sor {Klebsiella pneumoniae}
mqitlariddrlihgqvttvwskvanaqriiicnddvfndevrrtllrqaappgmkvnvv
slekavavyhnpqyqdetvfylftnphdvltmvrqgvqiatlniggmawrpgkkqltkav
sldpqdiqafreldklgvkldlrvvasdpsvnildkinetafc

Timeline for d1nrza_:

• d1nrza_ is new in SCOP 1.65
  
• d1nrza_ appears in SCOP 1.67
  
• d1nrza_ appears in the current release, SCOPe 2.08