Lineage for d1nrza_ (1nrz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873203Fold c.38: PTS IIb component [52727] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156
  4. 2873204Superfamily c.38.1: PTS IIb component [52728] (2 families) (S)
  5. 2873205Family c.38.1.1: PTS IIb component [52729] (2 proteins)
    automatically mapped to Pfam PF03830
  6. 2873209Protein Sorbose permease subunit IIb , EIIb-sor [89690] (1 species)
  7. 2873210Species Klebsiella pneumoniae [TaxId:573] [89691] (1 PDB entry)
  8. 2873211Domain d1nrza_: 1nrz A: [86131]
    complexed with so4

Details for d1nrza_

PDB Entry: 1nrz (more details), 1.75 Å

PDB Description: Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution
PDB Compounds: (A:) PTS system, sorbose-specific IIB component

SCOPe Domain Sequences for d1nrza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrza_ c.38.1.1 (A:) Sorbose permease subunit IIb , EIIb-sor {Klebsiella pneumoniae [TaxId: 573]}
mqitlariddrlihgqvttvwskvanaqriiicnddvfndevrrtllrqaappgmkvnvv
slekavavyhnpqyqdetvfylftnphdvltmvrqgvqiatlniggmawrpgkkqltkav
sldpqdiqafreldklgvkldlrvvasdpsvnildkinetafc

SCOPe Domain Coordinates for d1nrza_:

Click to download the PDB-style file with coordinates for d1nrza_.
(The format of our PDB-style files is described here.)

Timeline for d1nrza_: