SCOPe 2.07: Domain d1nrwa_: 1nrw A:

Lineage for d1nrwa_ (1nrw A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein YwpJ [89646] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89647] (1 PDB entry)

8. Domain d1nrwa_: 1nrw A: [86128]
   structural genomics
   complexed with ca, po4

Details for d1nrwa_

PDB Entry: 1nrw, 1.7 Å

PDB Description: the structure of a haloacid dehalogenase-like hydrolase from b. subtilis

PDB Compounds: (A:) hypothetical protein, haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d1nrwa_:

Sequence; same for both SEQRES and ATOM records:

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}
mkliaidldgtllnskhqvslenenalrqaqrdgievvvstgrahfdvmsifeplgiktw
visangavihdpegrlyhhetidkkraydilswlesenyyyevftgsaiytpqngrelld
veldrfrsanpeadlsvlkqaaevqysqsgfayinsfqelfeadepidfynilgfsffke
kleagwkryehaedltlvssaehnfelssrkaskgqalkrlakqlnipleetaavgdsln
dksmleaagkgvamgnarediksiadavtltndehgvahmmkhll

Timeline for d1nrwa_:

• d1nrwa_ first appeared in SCOP 1.65
  
• d1nrwa_ appears in SCOPe 2.06
  
• d1nrwa_ appears in the current release, SCOPe 2.08