Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Hypothetical protein YwpJ [89646] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89647] (1 PDB entry) |
Domain d1nrwa_: 1nrw A: [86128] structural genomics complexed with ca, po4 |
PDB Entry: 1nrw (more details), 1.7 Å
SCOPe Domain Sequences for d1nrwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} mkliaidldgtllnskhqvslenenalrqaqrdgievvvstgrahfdvmsifeplgiktw visangavihdpegrlyhhetidkkraydilswlesenyyyevftgsaiytpqngrelld veldrfrsanpeadlsvlkqaaevqysqsgfayinsfqelfeadepidfynilgfsffke kleagwkryehaedltlvssaehnfelssrkaskgqalkrlakqlnipleetaavgdsln dksmleaagkgvamgnarediksiadavtltndehgvahmmkhll
Timeline for d1nrwa_: