Lineage for d1nrjb_ (1nrj B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595272Protein Signal recognition particle receptor beta-subunit [89664] (2 species)
  7. 1595273Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89665] (1 PDB entry)
  8. 1595274Domain d1nrjb_: 1nrj B: [86125]
    Other proteins in same PDB: d1nrja_
    complexed with edo, gtp, mg

Details for d1nrjb_

PDB Entry: 1nrj (more details), 1.7 Å

PDB Description: signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit
PDB Compounds: (B:) Signal recognition particle receptor beta subunit

SCOPe Domain Sequences for d1nrjb_:

Sequence, based on SEQRES records: (download)

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
syqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlvdfpghvklr
yklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitesscengidiliacnk
selftarppskikdaleseiqkvierrkkslneverkineedyaentldvlqstdgfkfa
nleasvvafegsinkrkisqwrewidekl

Sequence, based on observed residues (ATOM records): (download)

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
syqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlvdfpghvklr
yklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitesscengidiliacnk
selftarppskikdaleseiqkvierrkkslneldvlgfkfanleasvvafegsinkrki
sqwrewidekl

SCOPe Domain Coordinates for d1nrjb_:

Click to download the PDB-style file with coordinates for d1nrjb_.
(The format of our PDB-style files is described here.)

Timeline for d1nrjb_: