SCOP 1.65: Domain d1nrjb_: 1nrj B:

Lineage for d1nrjb_ (1nrj B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Signal recognition particle receptor beta-subunit [89664] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89665] (1 PDB entry)

8. Domain d1nrjb_: 1nrj B: [86125]
   Other proteins in same PDB: d1nrja_
   complexed with edo, gtp, mg

Details for d1nrjb_

PDB Entry: 1nrj, 1.7 Å

PDB Description: signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit

SCOP Domain Sequences for d1nrjb_:

Sequence, based on SEQRES records:

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae)}
syqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlvdfpghvklr
yklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitesscengidiliacnk
selftarppskikdaleseiqkvierrkkslneverkineedyaentldvlqstdgfkfa
nleasvvafegsinkrkisqwrewidekl

Sequence, based on observed residues (ATOM records):

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae)}
syqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlvdfpghvklr
yklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitesscengidiliacnk
selftarppskikdaleseiqkvierrkkslneldvlgfkfanleasvvafegsinkrki
sqwrewidekl

Timeline for d1nrjb_:

• d1nrjb_ is new in SCOP 1.65
  
• d1nrjb_ appears in SCOP 1.67
  
• d1nrjb_ appears in the current release, SCOPe 2.08