Lineage for d1nrja_ (1nrj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922955Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1922988Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins)
  6. 1922993Protein Srx domain of the signal recognition particle receptor alpha-subunit [90020] (1 species)
  7. 1922994Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90021] (1 PDB entry)
  8. 1922995Domain d1nrja_: 1nrj A: [86124]
    Other proteins in same PDB: d1nrjb_
    complexed with edo, gtp, mg

Details for d1nrja_

PDB Entry: 1nrj (more details), 1.7 Å

PDB Description: signal recognition particle receptor beta-subunit in complex with the srx domain from the alpha-subunit
PDB Compounds: (A:) Signal recognition particle receptor alpha subunit homolog

SCOPe Domain Sequences for d1nrja_:

Sequence, based on SEQRES records: (download)

>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl
ltinsehknspsfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlse
silknrqgqneknkhnyvdilqgieddlkkfeqyf

Sequence, based on observed residues (ATOM records): (download)

>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl
ltinfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlsesilknrqg
qneknkhnyvdilqgieddlkkfeqyf

SCOPe Domain Coordinates for d1nrja_:

Click to download the PDB-style file with coordinates for d1nrja_.
(The format of our PDB-style files is described here.)

Timeline for d1nrja_: