Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.4: SNARE-like [64356] (5 families) beta(2)-alpha-beta(3)-alpha(2) |
Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins) |
Protein Srx domain of the signal recognition particle receptor alpha-subunit [90020] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90021] (1 PDB entry) |
Domain d1nrja_: 1nrj A: [86124] Other proteins in same PDB: d1nrjb_ complexed with edo, gtp, mg |
PDB Entry: 1nrj (more details), 1.7 Å
SCOPe Domain Sequences for d1nrja_:
Sequence, based on SEQRES records: (download)
>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl ltinsehknspsfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlse silknrqgqneknkhnyvdilqgieddlkkfeqyf
>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl ltinfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlsesilknrqg qneknkhnyvdilqgieddlkkfeqyf
Timeline for d1nrja_: