Lineage for d1nr9a1 (1nr9 A:1-219)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237274Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2237275Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2237276Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2237326Protein Putative isomerase YcgM [90070] (1 species)
  7. 2237327Species Escherichia coli [TaxId:562] [90071] (1 PDB entry)
  8. 2237328Domain d1nr9a1: 1nr9 A:1-219 [86119]
    Other proteins in same PDB: d1nr9a2, d1nr9a3, d1nr9c2, d1nr9d2
    structural genomics
    complexed with mg

Details for d1nr9a1

PDB Entry: 1nr9 (more details), 2.7 Å

PDB Description: Crystal Structure of Escherichia coli 1262 (APC5008), Putative Isomerase
PDB Compounds: (A:) Protein YCGM

SCOPe Domain Sequences for d1nr9a1:

Sequence, based on SEQRES records: (download)

>d1nr9a1 d.177.1.1 (A:1-219) Putative isomerase YcgM {Escherichia coli [TaxId: 562]}
myqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqplai
psdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwek
akafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskff
tlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvl

Sequence, based on observed residues (ATOM records): (download)

>d1nr9a1 d.177.1.1 (A:1-219) Putative isomerase YcgM {Escherichia coli [TaxId: 562]}
myqhhnwqgalldypvskvvcvgsnyapeepvlfikpetalcdlrqplaipsdfgsvhhe
velavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscpl
sgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvlt
gtpdgvgplqsgdeltvtfdghslttrvl

SCOPe Domain Coordinates for d1nr9a1:

Click to download the PDB-style file with coordinates for d1nr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1nr9a1: