Lineage for d1nr7l2 (1nr7 L:6-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498098Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2498099Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2498107Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries)
  8. 2498152Domain d1nr7l2: 1nr7 L:6-208 [86118]
    Other proteins in same PDB: d1nr7a1, d1nr7b1, d1nr7c1, d1nr7d1, d1nr7e1, d1nr7f1, d1nr7g1, d1nr7h1, d1nr7i1, d1nr7j1, d1nr7k1, d1nr7l1

Details for d1nr7l2

PDB Entry: 1nr7 (more details), 3.3 Å

PDB Description: crystal structure of apo bovine glutamate dehydrogenase
PDB Compounds: (L:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d1nr7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr7l2 c.58.1.1 (L:6-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1nr7l2:

Click to download the PDB-style file with coordinates for d1nr7l2.
(The format of our PDB-style files is described here.)

Timeline for d1nr7l2: