Lineage for d1nr7l1 (1nr7 L:209-501)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309102Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 309103Protein Glutamate dehydrogenase [51884] (7 species)
  7. 309129Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
  8. 309159Domain d1nr7l1: 1nr7 L:209-501 [86117]
    Other proteins in same PDB: d1nr7a2, d1nr7b2, d1nr7c2, d1nr7d2, d1nr7e2, d1nr7f2, d1nr7g2, d1nr7h2, d1nr7i2, d1nr7j2, d1nr7k2, d1nr7l2

Details for d1nr7l1

PDB Entry: 1nr7 (more details), 3.3 Å

PDB Description: crystal structure of apo bovine glutamate dehydrogenase

SCOP Domain Sequences for d1nr7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr7l1 c.2.1.7 (L:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

SCOP Domain Coordinates for d1nr7l1:

Click to download the PDB-style file with coordinates for d1nr7l1.
(The format of our PDB-style files is described here.)

Timeline for d1nr7l1: