![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries) |
![]() | Domain d1nr7k1: 1nr7 K:209-501 [86115] Other proteins in same PDB: d1nr7a2, d1nr7b2, d1nr7c2, d1nr7d2, d1nr7e2, d1nr7f2, d1nr7g2, d1nr7h2, d1nr7i2, d1nr7j2, d1nr7k2, d1nr7l2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nr7 (more details), 3.3 Å
SCOPe Domain Sequences for d1nr7k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr7k1 c.2.1.7 (K:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft
Timeline for d1nr7k1: