Lineage for d1nr7h2 (1nr7 H:6-208)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489481Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 489482Protein Glutamate dehydrogenase [53225] (7 species)
  7. 489508Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 489522Domain d1nr7h2: 1nr7 H:6-208 [86110]
    Other proteins in same PDB: d1nr7a1, d1nr7b1, d1nr7c1, d1nr7d1, d1nr7e1, d1nr7f1, d1nr7g1, d1nr7h1, d1nr7i1, d1nr7j1, d1nr7k1, d1nr7l1

Details for d1nr7h2

PDB Entry: 1nr7 (more details), 3.3 Å

PDB Description: crystal structure of apo bovine glutamate dehydrogenase

SCOP Domain Sequences for d1nr7h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr7h2 c.58.1.1 (H:6-208) Glutamate dehydrogenase {Cow (Bos taurus)}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1nr7h2:

Click to download the PDB-style file with coordinates for d1nr7h2.
(The format of our PDB-style files is described here.)

Timeline for d1nr7h2: