Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Glutamate dehydrogenase [51884] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [75115] (2 PDB entries) |
Domain d1nr1f1: 1nr1 F:213-505 [86090] Other proteins in same PDB: d1nr1a2, d1nr1b2, d1nr1c2, d1nr1d2, d1nr1e2, d1nr1f2 |
PDB Entry: 1nr1 (more details), 3.3 Å
SCOP Domain Sequences for d1nr1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr1f1 c.2.1.7 (F:213-505) Glutamate dehydrogenase {Human (Homo sapiens)} hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi vhsglaytmeasarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft
Timeline for d1nr1f1: