![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein Actin interacting protein 1 [89378] (2 species) 14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries) |
![]() | Domain d1nr0a2: 1nr0 A:313-611 [86079] complexed with mn |
PDB Entry: 1nr0 (more details), 1.7 Å
SCOPe Domain Sequences for d1nr0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} lgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrvfpdvhatmitg ikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsadgdiavaacyk hiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgasvsevktivhpa eitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvacvswspdnvrla tgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqdsnikfwnvpf
Timeline for d1nr0a2: