Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (3 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Actin interacting protein 1 [89378] (2 species) 14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries) |
Domain d1nr0a1: 1nr0 A:2-312 [86078] complexed with mn |
PDB Entry: 1nr0 (more details), 1.7 Å
SCOPe Domain Sequences for d1nr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis angfinfvnpe
Timeline for d1nr0a1: