Lineage for d1nqtl2 (1nqt L:6-208)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317636Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 317637Protein Glutamate dehydrogenase [53225] (7 species)
  7. 317663Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 317705Domain d1nqtl2: 1nqt L:6-208 [86075]
    Other proteins in same PDB: d1nqta1, d1nqtb1, d1nqtc1, d1nqtd1, d1nqte1, d1nqtf1, d1nqtg1, d1nqth1, d1nqti1, d1nqtj1, d1nqtk1, d1nqtl1
    complexed with adp

Details for d1nqtl2

PDB Entry: 1nqt (more details), 3.5 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase-adp complex

SCOP Domain Sequences for d1nqtl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqtl2 c.58.1.1 (L:6-208) Glutamate dehydrogenase {Cow (Bos taurus)}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1nqtl2:

Click to download the PDB-style file with coordinates for d1nqtl2.
(The format of our PDB-style files is described here.)

Timeline for d1nqtl2: