Lineage for d1nqth1 (1nqt H:209-501)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349489Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1349490Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1349498Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries)
  8. 1349542Domain d1nqth1: 1nqt H:209-501 [86066]
    Other proteins in same PDB: d1nqta2, d1nqtb2, d1nqtc2, d1nqtd2, d1nqte2, d1nqtf2, d1nqtg2, d1nqth2, d1nqti2, d1nqtj2, d1nqtk2, d1nqtl2
    complexed with adp

Details for d1nqth1

PDB Entry: 1nqt (more details), 3.5 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase-adp complex
PDB Compounds: (H:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d1nqth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqth1 c.2.1.7 (H:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

SCOPe Domain Coordinates for d1nqth1:

Click to download the PDB-style file with coordinates for d1nqth1.
(The format of our PDB-style files is described here.)

Timeline for d1nqth1: