SCOPe 2.08: Domain d1nqte1: 1nqt E:209-501

Lineage for d1nqte1 (1nqt E:209-501)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries)

8. Domain d1nqte1: 1nqt E:209-501 [86060]
   Other proteins in same PDB: d1nqta2, d1nqtb2, d1nqtc2, d1nqtd2, d1nqte2, d1nqtf2, d1nqtg2, d1nqth2, d1nqti2, d1nqtj2, d1nqtk2, d1nqtl2
   complexed with adp
   has additional insertions and/or extensions that are not grouped together

Details for d1nqte1

PDB Entry: 1nqt, 3.5 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase-adp complex

PDB Compounds: (E:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d1nqte1:

Sequence; same for both SEQRES and ATOM records:

>d1nqte1 c.2.1.7 (E:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

Timeline for d1nqte1:

• d1nqte1 first appeared in SCOP 1.65
  
• d1nqte1 appears in SCOPe 2.07