| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
| Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries) |
| Domain d1nqoq2: 1nqo Q:149-312 [86051] Other proteins in same PDB: d1nqoa1, d1nqoc1, d1nqoo1, d1nqoq1 complexed with g3h, nad; mutant |
PDB Entry: 1nqo (more details), 2.01 Å
SCOPe Domain Sequences for d1nqoq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqoq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
sttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d1nqoq2: