Lineage for d1nqoo2 (1nqo O:149-312)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606585Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 606597Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
  8. 606608Domain d1nqoo2: 1nqo O:149-312 [86049]
    Other proteins in same PDB: d1nqoa1, d1nqoc1, d1nqoo1, d1nqoq1

Details for d1nqoo2

PDB Entry: 1nqo (more details), 2.01 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+ and d-glyceraldehyde-3-phosphate

SCOP Domain Sequences for d1nqoo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqoo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
sttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1nqoo2:

Click to download the PDB-style file with coordinates for d1nqoo2.
(The format of our PDB-style files is described here.)

Timeline for d1nqoo2: