Lineage for d1nqoc1 (1nqo C:0-148,C:313-333)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828874Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
  8. 1828884Domain d1nqoc1: 1nqo C:0-148,C:313-333 [86046]
    Other proteins in same PDB: d1nqoa2, d1nqoc2, d1nqoo2, d1nqoq2
    complexed with g3h, nad; mutant

Details for d1nqoc1

PDB Entry: 1nqo (more details), 2.01 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+ and d-glyceraldehyde-3-phosphate
PDB Compounds: (C:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nqoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqoc1 c.2.1.3 (C:0-148,C:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d1nqoc1:

Click to download the PDB-style file with coordinates for d1nqoc1.
(The format of our PDB-style files is described here.)

Timeline for d1nqoc1: