Lineage for d1nqoa2 (1nqo A:149-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915823Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 1915832Domain d1nqoa2: 1nqo A:149-312 [86045]
    Other proteins in same PDB: d1nqoa1, d1nqoc1, d1nqoo1, d1nqoq1
    complexed with g3h, nad; mutant

Details for d1nqoa2

PDB Entry: 1nqo (more details), 2.01 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+ and d-glyceraldehyde-3-phosphate
PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nqoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqoa2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
sttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d1nqoa2:

Click to download the PDB-style file with coordinates for d1nqoa2.
(The format of our PDB-style files is described here.)

Timeline for d1nqoa2: