Lineage for d1nqoa1 (1nqo A:0-148,A:313-333)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575246Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 575258Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)
  8. 575267Domain d1nqoa1: 1nqo A:0-148,A:313-333 [86044]
    Other proteins in same PDB: d1nqoa2, d1nqoc2, d1nqoo2, d1nqoq2

Details for d1nqoa1

PDB Entry: 1nqo (more details), 2.01 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+ and d-glyceraldehyde-3-phosphate

SCOP Domain Sequences for d1nqoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqoa1 c.2.1.3 (A:0-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1nqoa1:

Click to download the PDB-style file with coordinates for d1nqoa1.
(The format of our PDB-style files is described here.)

Timeline for d1nqoa1: