Lineage for d1nqnb_ (1nqn B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468177Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 468178Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 468179Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 468180Protein Avidin [50880] (1 species)
  7. 468181Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 468183Domain d1nqnb_: 1nqn B: [86043]

Details for d1nqnb_

PDB Entry: 1nqn (more details), 1.8 Å

PDB Description: structure of avm-w110k (w110k mutant of avidin)

SCOP Domain Sequences for d1nqnb_:

Sequence, based on SEQRES records: (download)

>d1nqnb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d1nqnb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttkesplhgtentinkrtqptfgftvnwk
fsesttvftgqcfidngkevlktmwllrssvndigddkkatrvginiftrl

SCOP Domain Coordinates for d1nqnb_:

Click to download the PDB-style file with coordinates for d1nqnb_.
(The format of our PDB-style files is described here.)

Timeline for d1nqnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nqna_